McDonnell Genome Institute

Washington University

CircRNA

chr10|120871169|120906021|+|WDR11|ENST00000263461.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9004

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

FTGQSAIAGEEHPR

Amino Acids from 5' Exons

GKVQLLGKNIPEVQFCGKCTSSSCRDCFQDCPHHSLLFVCVHRPQKTSRCISHCWLL,AKCNCWGRTSQRFNSAGSAPQVPADGTAFRTARTTVCYSYVSTVDHKKHQDVSATAGC,QSAIAGEEHPRGSILREVHLKFLLTGLLSGLPAPQFAIRMCPPLTTKNIKMYQPLLAV

Amino Acids from 3' Exons

VRLNPEECADVLRRWVDHLCSPQVNQKSKALLVLLSLGCFFSVAETLH,SVILRSVPMFGGGLTTFVLHKSIRNQRLSWFSSLWAAFLAWQRRFT,PFESGVCRCFKAVGPPLFSTSQSEIKGSPGSPLSGLLFRGRDASQ