McDonnell Genome Institute

Washington University

CircRNA

chr10|119576610|119582608|-|TIAL1|ENST00000369093.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

27

Peptide

VNSSVGFSVLQHTSNDPYCFVEFYEHR

Amino Acids from 5' Exons

VDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGV,LTIVNGANGAKCMETHNSMDSIWQMGGKYRLMEYTGNHGINKDLE,LSMGPMEPSVWKPTTVWTVYGKWVASTALWSIRATMESTRIWSR

Amino Acids from 3' Exons

QPDSRRVNSSVGFSVLQHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGK,NPIAEGSTLLLDFLFCSIQAMTHIALWNFMNTEMQLLHLLMGEKFWE,TRQKGQLFCWIFCFAAYKQPILLCGILTQRCSCCISCYEWEKNFGK