McDonnell Genome Institute

Washington University

CircRNA

chr10|119430374|119448260|+|GRK5|ENST00000392870.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9024

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

13

Peptide

LEAGMLDPPFVPDATGDQK

Amino Acids from 5' Exons

ATGDQKHFQAVSSARKRGLRG,QPVTKNTFRQYRVLGKGGFGE,NRPKTLSGSIECEKGASG

Amino Acids from 3' Exons

LLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPD,CSRKMRSRGWAARRRGLQRSRDTPSSGTTSSAKPGCWTLPSFQ,AHERCEAEAGLPGGGGCRGQETPLLQEHELQALRSRDVGPSLRSR