McDonnell Genome Institute

Washington University

CircRNA

chr10|11929864|12014184|-|UPF2|ENST00000356352.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9611

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

TGGRRILHSK

Amino Acids from 5' Exons

KCCSLLHSAQLQQTPIVRGGLATNIRREHLMQISLRLVG,NVAVSCTAPSSSKHQSEAASLPTSEGSTCRSNLDWWE,MLQSLAQRPAPANTNRERRPRYQHPKGAPNADLIFKTGG

Amino Acids from 3' Exons

AHSTFRGAQRTTVGICYVLPEAAGKFSILSRPFGKYARSSSRQTNTR,RILHSKGELSEDRHKQYEEFAMSYQKLLANSQSLADLLDENMPDLPQDKPTPE,AFYILKGSSVKIDINSMRNLLCLTRSCWQILNPQTFWMKICQIFLKTNQHQK