McDonnell Genome Institute

Washington University

CircRNA

chr10|119069445|119073937|-|EIF3A|ENST00000369144.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9947

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

MRCKEFLEVGK

Amino Acids from 5' Exons

EAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQ,KHSKLWKIFTGYSPCLKNHLNLSWQITITKSQLCFGNLEMLFFMHLHSIVFTISLEKERISHKMRCK,SIQSCGRYSRAILLVKTTTSVDGKLLQSLNCVLEIWKCSFSCIYTPSSLPSLRNEKESHTRDAK

Amino Acids from 3' Exons

NFLRLAKSSLLWMFFMMLKVKNIEHGKRYTNQLCNTWNFAWIFARATWQRRGYTSIRTFVN,ISGWQKAACSGCSLCYEKKTNMAKDTRTNYVEILGTLRGSSQEPLGKGGVIPVEHLST,FLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQ