McDonnell Genome Institute

Washington University

CircRNA

chr10|119065398|119069654|-|EIF3A|ENST00000369144.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9384

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

4

Peptide

IGLINDMEAFK

Amino Acids from 5' Exons

NVYSPFSHSFHPYYSAYGYCSTSGYGWHYSKTASPCNTTRSSSPTDTNWPYY,MSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQAPPTRIGLINDM,CLLESFPLFPSLLLLSVRILLDFWIWMALLKNSVALQHYVFKPHRHELALLMI

Amino Acids from 3' Exons

EAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLYHLSREMRKNLTQDEMQ,KHSKLWKIFTGYSPCLKNHLNLSWQITITKSQLCFGNLEMLFFMHLHSIVFTISLEKERISHKMRCK,SIQSCGRYSRAILLVKTTTSVDGKLLQSLNCVLEIWKCSFSCIYTPSSLPSLRNEKESHTRDAK