McDonnell Genome Institute

Washington University

CircRNA

chr10|119059211|119073937|-|EIF3A|ENST00000369144.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

ALEVIKPAHILNFLR

Amino Acids from 5' Exons

VRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHIL,FVLITLLGPVLDLIIMLLEKMLRLVLICKACLQSRETSQPCPQYLQKHLKSLNQLIY,SYSHFSDPEFWIFELCYSRRCSDWSSFAKHAFRADKKPADSHVLSTCKSTSHTSSYT

Amino Acids from 3' Exons

NFLRLAKSSLLWMFFMMLKVKNIEHGKRYTNQLCNTWNFAWIFARATWQRRGYTSIRTFVN,ISGWQKAACSGCSLCYEKKTNMAKDTRTNYVEILGTLRGSSQEPLGKGGVIPVEHLST,FLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYKNICQQ