McDonnell Genome Institute

Washington University

CircRNA

chr10|114845366|114847233|+|FAM160B1|ENST00000369248.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9052

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

IVNSLDSYSHK

Amino Acids from 5' Exons

LGLISRRCFSISRKTSLNFISFLVLLSAHGSPK,LDSYSHKEDASAFPGKRALISFLSWFDYCDQLIKEAQK,WTHIVIKKMLQHFQENEPFHFFPGLIIVISSLRKPK

Amino Acids from 3' Exons

RSGRRSIIYHFTRKHFAKPRVAFFTSCYSRPPQKWKNSSNCK,DLEEDPLFTDISPENTLPNQEWLSSSPPATPDHPKNDGKTEVHKIVN,IWKKIHYLLTFHQKTLCQTKSGLVLHLLLLQTTPKMMEKLKFIKLI