McDonnell Genome Institute

Washington University

CircRNA

chr10|113841405|113853847|-|DCLRE1A|ENST00000369305.1

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9985

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LLQENSVELK

Amino Acids from 5' Exons

PLLMFVQKWACPRKNIKLYSASIYQKLIHSSLPTCAVHWFTFSQCKLIL,HCCFRFKSGHVPGKINSTVPQYTRNFTHHYRHVQFIGSPSPNDANF,IADVLGSKVGMSQEKYKTLQCLNIPEINSLITTDMCSSLVHLLPMMQINFK

Amino Acids from 3' Exons

GLFIAAGGRSWTVAGNSGVSTSRGGQLRSFLRITHLFDYVVTSFVRSFSVWDTCALCPGTVVGFMNYLDGCPLERTDSSFITMLQISFDAVEPIFAISAFLKYYFYESSPGKGQDIMKHPWRTSQLLLLVYLSFIVVMEQVLSGTRFVACQYVHYQHCRFPLSWWGFCYLCFFSQQNNSITFCLQEMDFQFTDYFLNDKIILPCKTFPKKTFGNTNLKENQNELIQIMALKIFNLLKKQQMENTSQNGVETEKEPQKLKRRTMKCPLEMQVVRLLLLLVRIQVVEMVFSRPKTRKLLQENSVELKKANTCPQRYVQFMMDTVQIARCLFPHGRHLDGMFLNVWILHHALKQ,DCSLLLEEDHGLSRETEVVEYPLVVDEGSDFAVFCELHISLIMLLVLLDSHLVFGIPVKPFVQGLWLDLIIWTVVHLKELTVASQCYKSRSKIKLLNLYLPLALNFSIIFMNQALEKDKIFENSTHNGELHSCYSCDRFILVSLWYKWNSRCCQVQGLLANMFITNTADSHVGGGFVTFVFFLSKIILLFVCDKKWTFSLLKINTSMIKSFCHVRRHFRRRHLGIQIKKTKTSSKWLKYSKICKSNRWKIPVKTEKQKKSRRSRGEGPSAPWKCRLSDFCCFSEFKLWRWYSADPRQGNYSRKTLNSKKPTRVPKDTSSLWILSKLPDAFFLIDRADTSMACFMFGFSTTLN,IVHCCWRKIMDCRGKLKWLSIHSWMRAVTSQFFANYTSLLCCDFCIVICLGYLLSPLSRDCGWIYELFGRLSTKNQLHNNVTNLVLRLSCTYICHRLIFEVLFLIKPWKRTRYLNEIAPIMENFTVATPVIGLSFHCGINGIAGVVRYKVCSLPICSLPTLQIPIELVGVLLPLFFFSAKFYNFLFVTRNGLSVYLRLILLENHFAMLEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNRKRAAEAKEVKDHEVPLGNAGCQTSVASSQNSSCGDGIQQTQDKETTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSET