McDonnell Genome Institute

Washington University

CircRNA

chr10|113697493|113726434|+|CASP7|ENST00000345633.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9587

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LMMASRPTR

Amino Acids from 5' Exons

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLF,WQMIRAVLKSRGLRIQQMKIQWMLSQTGPRLYRPSS,GRSGLYRAGGGFSKRFSGCARPVLVCTVPLQ

Amino Acids from 3' Exons

ACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVP,LAEGPSLMMASRPTRGPSMTQMLILDTRSQWKLTSSSPIPRFQ,LPRDRAWHPGRLGAHQHRCSSIQDPSGSLPLRLFHGS