McDonnell Genome Institute

Washington University

CircRNA

chr10|110881232|110894522|+|PDCD4|ENST00000280154.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9405

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

21

2

Peptide

NPDNLSDSLFSGDEENAGTEEIK

Amino Acids from 5' Exons

ILITVTLSFPVMKKMLGLRKRMKMEIGFQHPPLTKLELMPRQKGDGKTHPGTLAEAIRSATVGVTPLEVDLCQPVQREGCWIGDPDLGKEGDYQRK,SLKLSLFRRKCWDGNKENKWKLDFSILHRSNCQGKKATKEKLIPGLWQRRFGQRQWERPKWINCANQSKGKVAGAIQIWERKGTTKE,PDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAKRRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKK

Amino Acids from 3' Exons

AIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKR,LLWFSQLEKVHLRFWIYSPFGSLLPLLTKK,YYNGFRVNWRKYIDDFGFIKVPLEVFYHYCRPNEK