McDonnell Genome Institute

Washington University

CircRNA

chr10|110593072|110598290|+|SMC3|ENST00000361804.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9831

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

5

Peptide

TFMPKDAIPMISK

Amino Acids from 5' Exons

DAIPMISKLRYNPRFDKAFKHVFGKTLICRSMEVSTQLARAFTMDCITLE,MLFLSANGTIPDLTKLSNMCLERLLFVVAWKFQPSWPVLSLWTVLLWK,CYSYDQQTEVQSQIQSFQTCVWKDSYLSHGSFNPAGPCFHYGLYYFG

Amino Acids from 3' Exons

GLIMKLISTKCNRSRPSKGNLKHLEIAYYQKRCKRRGSSQRKPSCL,DNSVDEPNATDRDPAKEISIRHIIRNEDAKREEAAVRENLHA,INNEIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPK