McDonnell Genome Institute

Washington University

CircRNA

chr10|110584182|110599812|+|SMC3|ENST00000361804.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9385

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

MRFVNFSRLAQATQER

Amino Acids from 5' Exons

IGSSYPGKNGSLCKAGSRKPVYIKRRKGVDKGTQVFRSGYQEKTDCCYTGFGRHSKREKSGAV,LAQATQERTDLYAKQGRGSQFTSKEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYN,WLKLPRKERIFMQSRVEEASLHQKKKGISGLKRNSSLIRLLMTRKDRLLLYIRIWKTLKQIKRKIWSSI

Amino Acids from 3' Exons

QRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQKRVDALNDEIRQLQQ,NVAYRVWRQACMLWSLPESHKQNWELICFLNVWKIRREMHMMRFVNFS,TLTEFGGKLACYGVYQRVIESRTGNFAFSTEFGRSEESRCTEDSSTSA