McDonnell Genome Institute

Washington University

CircRNA

chr10|110295227|110298790|-|SMNDC1|ENST00000369592.1

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9039

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

GQEVIELTK

Amino Acids from 5' Exons

KRNDCPAAIKEESFEKSSENKRTAGKRGPESEMATIQQQSLFKQKRP,KEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQ,KKLPSSVNIKRRKLKKLREKNLSRKERTRKNGNNSTTEPILKTKKA

Amino Acids from 3' Exons

EVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDG,KLNPKTFCQLNLLRRLQVQTVLLLLNLLIHGKETSVWQSGVKMD,SYRTNQRPSVNSTFDACKFRQFCFYSTYSFMESRRQVYGSLERWT