McDonnell Genome Institute

Washington University

CircRNA

chr10|110118586|110122292|+|ADD3|ENST00000277900.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9428

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

TLDNLVK

Amino Acids from 5' Exons

VKVNIIGEVVDQGSTNLKIDHTGFSPHAAIYSTRPDVKCVIHIHTLATAA,KSIEKWLTREVPIKLTIQDSVPMLQSIQHVLMLSVYTSIPLQQQ,ESQYNRRSGPGKYQFENPYRIQSPCCNLFNTSCVCDTHPYPCNSS

Amino Acids from 3' Exons

VQALAGAGGVDNLHVLDFQKYKAFTYTVAASGGGGVNMGSHQKWKVGEIEFEGLMRTLDNL,CRPQVQVETISMYWTFRSIKLSLTLQRLVEEVIWVPIKNGRLAKLSLKGLGLWTT,AGPSRCRWSRQSPCTGLSEVSFHLHCSSVWWRRCEYGFPSKMEGWRNVRAYEDSGQL