McDonnell Genome Institute

Washington University

CircRNA

chr10|104122964|104124124|+|SFR1|ENST00000369727.3

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9174

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

QTQLWFYLALLRPLR

Amino Acids from 5' Exons

RKTKISLSRWKVRQTQLWFYLALLRPLRIHHLPIQIVPEN,EKPRFHFQDGKSVRLSCGFTHSSGLCESIISLYKFPKT,KNQDFTFKMESPSDSAVVLPSTPQASANPSSPYTNSSRKQ

Amino Acids from 3' Exons

PMSATLRERLRKTRFSFNSSYNVVKRLKVESEENDQTFSEKPASSTEENCLEFQESFKHIDSEFEENTNLKNTLKNLNVCESQSLDSGSCSALQNEFVSEKLPKQRLNAEKAKLVKQVQEKEDLLRRLKLVKMYRSK,LVQHLEKDGKQDFHLIPLTMWNVLKRVKKMIRPFQRNQHLPQRKTVWNFKKVLNITVNLKKIQIKILRISMSVNLSHLILDHAVLSKMSLVRSFLNKDTLKKPNWSRFRRKKTFFGGNSKCIDQ,YECNTRKIKENKIFIFLLQCGETSSRERKSDLFRETSIFHRGKLFGISRKFTYRQIRKYKFEKYFEESQCLISVTFWIMQCSPKVCEEASTKIKRKSQIGEAGSGERRPSSEAKTSQNVIK