McDonnell Genome Institute

Washington University

CircRNA

chr10|103570871|103571822|+|NEURL1|ENST00000369780.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9107

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

5

Peptide

GVQLLDSIGGPFPVTSHR

Amino Acids from 5' Exons

TLSGAPSPSLLTDATTSRSTVRQCCPAGGSQPRRCSSTRTPRAPRSSWTSATRLSRGRPASATPSPSATARSSSTSKSG,LYRGPLPRHFSPMPPQAEALSGSAAQRGAPSHAAALPPAHQGLPDPHGPQPQGCQEAGQLLQRHHLQQPPGPHLRASQAE,SIGGPFPVTSHRCHHKQKHCPAVLPSGGLPATPLLFHPHTKGSQILMDLSHKAVKRQASFCNAITFSNRPVLIYEQVRLK

Amino Acids from 3' Exons

ITKKQCCWSGALRLGFTSKDPSRIHPDSLPKYACPDLVSQSGFWAKALPEEFANEGNIIAFWVDKKGRVFHRINDSAVMLFFSGVRTADPLWALVDVYGLTRGVQLL,SPRSSAAGAGPCGWASPARTRPASTLTRCPSTPAPTWCPRVASGPRRCLRSLPMRATSSHSGWTRRAVSSTASTTRLLCCSSAGSARPTRSGPWWTSTASRGASSCL,HQEAVLLERGPAAGLHQQGPVPHPPLAAQVRLPRPGVPEWLLGQGAAGVCQGQHHRILGGQEGPCLPPHQRLGCYAVLQRGPHGRPALGPGGRLRPHAGRPAA