McDonnell Genome Institute

Washington University

CircRNA

chr10|103439745|103440581|+|PDCD11|ENST00000369797.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9649

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

LGSQTCFLLPWK

Amino Acids from 5' Exons

PWPLRCGFGSVLPCLPAQPVQESPLQTPPREAAHSQGPT,LGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTARVL,LAPPLWVWLGTPMSPSTARPRKPFITNTSLKGSCSQPGSY

Amino Acids from 3' Exons

PPPEEPGRAVFPPRRHWEARRAFCFLGRATYKARGEENRGGERPKRGKEKSEKEREEEPEGAGGGGDAQQGEATAPEATGAEAGRAGVPGVWEA,LNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEERKTEAEERDQKGEKKNQKRNEKKNQKGQEEVEMPSKEKQQPQKPQAQKRGGRECRESGSEQ,LTTRRTWSCLSSPETLGSQTCFLLPWKGNLQSKRRGKQRLRRETKKGKRKIRKGTRRRTRRGRRRWRCPARRSNSPRSHRRRSGAGGSAGSLGVS