McDonnell Genome Institute

Washington University

CircRNA

chr10|102159192|102160024|+|NOLC1|ENST00000370007.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

KVWTITSVR

Amino Acids from 5' Exons

LEQHLKPMVKQPVAAVAAAAAVAVMTQRRRRQQPPPRRSGPLLSGQ,SSSTNSQWSSQQQQQQQQQLRGGEGSSHPQEGLDHNFCQGR,RAAPKIANGKAASSSSSSSSSSSSDDSEEEKAAATPKKVWTITSVRAE

Amino Acids from 3' Exons

VPTVQSPRLLLPHQRSLWEPSLPRRLWRSSSLWKAVKTAVMSL,SLQFSPPAFCSPTKEVSGNPASQEGCGEAAACGKQRQQV,PYSSVPPPSAPPPKKSLGTQPPKKAVEKQQPVESSEDSSDES