McDonnell Genome Institute

Washington University

CircRNA

chr10|100983754|100986975|-|MRPL43|ENST00000299179.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9518

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

LARPINGAVR

Amino Acids from 5' Exons

DTGLRLSAVAPQILLPGWPDP,TLADCLQLHRRSSCPAGPT,HWPETVCSCTADPPARLARP

Amino Acids from 3' Exons

LTGLCARRASTASRSRRSRRWCRSWPTSRAWTSASASPSTPTTLASRASGTPSPTSRPRSAGYAPERFRILPQP,RGCARGEHPLQVGRGDLDAGAEAGRPVGLGRDPHPQALPHRQPHPGPVAPLHQQADHVPRATPPRGSGSCPSP,NGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQ