McDonnell Genome Institute

Washington University

CircRNA

chr10|100204505|100209789|-|CHUK|ENST00000370397.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9871

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

11

Peptide

MGYIVHILNMTSAK

Amino Acids from 5' Exons

VKSSICLNKNEEHFDLSITTTESIGVFSQKHSALGEIQRADDVWD,LSLLRYNANLTKMKNTLISASQQLKAKLEFFHKSIQLDLERYSEQMTYGI,VFLDIMLTQKRTLSQHHNNKLNWSFFTKAFSLTWRDTASRRMGY

Amino Acids from 3' Exons

IVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGISLDPRKPASQCVLDGV,YTSILLQRFLFCYHLMKVFIHYSLVLSVKLEILVLKNFFQRQEFLWILGNQPLNVFME,STHPKYDFCKDNFFSVTTKSSFTTVSYANWNKYWFSRTSFRDRNFSGSSETSLSMCSRWS