McDonnell Genome Institute

Washington University

CircRNA

chr1|9931890|9942782|-|LZIC|ENST00000377213.1

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9972

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

TGGLCNLRPVGTVQR

Amino Acids from 5' Exons

LTADDEAFLSANAGAILSQFEKVSTDL,LQMMRPSCQQMQVLYSASLRKSLQTL,DCRGLLVSKCRCYTQPVESLYRP

Amino Acids from 3' Exons

HLHPEVVTLSLLSIISFSSSLHSERQELEVCAIDRSALCRDQSTKRQ,ISTPRWFELAFCSPDEFHFPQVYDTRNVKNWRFVQFETGRHCAEIRVLRD,SPPRGGLNFEPFVVLMNNFIFLKFMTLGTSRTGGLCNLRPVGTVQRSEYET