McDonnell Genome Institute

Washington University

CircRNA

chr1|97699350|97828196|-|DPYD|ENST00000370192.7

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9754

63

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LLVSEELSEK

Amino Acids from 5' Exons

VFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGL,YSKQVSHRSEILRCLPQKKCLKPILQRLLFLVLGLQVVVLPFWLDWGTLTSLYLKNKNMLVV,IQSNEYPTDQKSFAASPRKNVSLFCKDCSFWCWACKYKLCFLFGSIGVLHHYIKTRICWWFK

Amino Acids from 3' Exons

NCEKLENNFDDIKHTTLGERGALREAM,IVRSWRIILMTSSTRLLVSEELSEKQ,LEAGEFHQAHDSWARSSPRSNE