McDonnell Genome Institute

Washington University

CircRNA

chr1|97549559|97679182|-|DPYD|ENST00000370192.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9896

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

YVQIICGK

Amino Acids from 5' Exons

KKPALNLTDGVSQKIQKLCKLVKHGYLQVVMSLVWLTLQWNRMMESKLLGTFTNTY,KRSLEPYKIQMGSPRSRSRNYANSMGICRWCRWFGHYSGIGEWKASFLVHSQIRT,KEALSPIKFNRWGLPEVDPETMQTSEAWVFAGGDVVGLANTTVESVNDGKQASWYIHKYVQ

Amino Acids from 3' Exons

IICGKSLSVNEMTLSTLKEKGYKAAFIGI,FAVKAFQMKLLALKKKATKLLSLE,NLRKPFSENDSHFERKRLQSCFHWN