McDonnell Genome Institute

Washington University

CircRNA

chr1|97450058|97699547|-|DPYD|ENST00000370192.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9965

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

ADFPDNVFK

Amino Acids from 5' Exons

DIVTNVSPRIIRGTTSGPMYGPGQSSFLNIELISEKTAAYWCQSVTELKADFPDN,TLQMFPPESSGEPPLAPCMALDKAPFILSSSVRKRLHIGVKVSLNRLTFQT,HCDKCFPQNHPGNHLWPHVWPWTKLLSEYAHQENGCILVSKCHTKGLSRQ

Amino Acids from 3' Exons

VFKAMSIPQIRNPSLPPPEKMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGL,YSKQVSHRSEILRCLPQKKCLKPILQRLLFLVLGLQVVVLPFWLDWGTLTSLYLKNKNMLVV,IQSNEYPTDQKSFAASPRKNVSLFCKDCSFWCWACKYKLCFLFGSIGVLHHYIKTRICWWFK