McDonnell Genome Institute

Washington University

CircRNA

chr1|96785058|96806958|+|PTBP2|ENST00000370197.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.99

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

8

Peptide

LMETNHNLALDGQNIYNACCTLR

Amino Acids from 5' Exons

ALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSLL,PMVRIFIMPAVPGLIFPNLIMNTTMIKVGIILDLIFHLGMDNLHWTQLLLQHLPRRHPS,PRWSEYLCLLYPKDFFQTCEFECKIQQKGLYSTSSIWGWTTCIGPSYCCSICQGDIPL

Amino Acids from 3' Exons

VFMEMCSVRFYTIRKTALYRWLMETNHNL,CLWRCAACEDFIQERQRSNTDGWKPITT,VYGDVQRVKILYNKKDSALIQMADGNQSQL