McDonnell Genome Institute

Washington University

CircRNA

chr1|94899370|94903524|-|CNN3|ENST00000370206.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9378

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

24

4

Peptide

MQTDKPFDQTTISLQMGTNKGASQIASK

Amino Acids from 5' Exons

MGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQ,WEPTNVPARQVQLTGLGGIFMIPKCKLTNLLTRPQLVCRWALIKEPA,GNQQMCQPGRYDSLRDEASLSQNANQTFPDHNSADGHRSQP

Amino Acids from 3' Exons

IASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILC,LLPSMIIRQKKIFAIGKRQAALAPTSSWARMASSSA,CFQVSSGRRRSSQLDRRGDRHEHWPQLPAGLKGWHHPLR