McDonnell Genome Institute

Washington University

CircRNA

chr1|93876267|93877862|-|DNTTIP2|ENST00000359208.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9594

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

VVLDLMPELLLNHRPLGSK

Amino Acids from 5' Exons

SFAANGIQAHPESSTGSDARTTAESQTTGKQSLIPRTPKARKRKSRTTGSLPKGTEPSTDGETSEAESNYSVSEHHDTILRVTRRRQILIACSPVSSVRKKPKVTPTKESYTEEIVSEAESHVSGISRIVLPTEKTTGARRSKAKSLTDPSQESHTEAISDAETSSSDISFSGIATRRTRSMQRKLKAQTEKKDSKIVPGNEKQIVGTPVNSEDSDTRQTSHLQARSLSEINKPNFYNNDFDDDFSHRSSENILTVHEQANVESLKETKQNCKDLDEDANGITDEGKEINEKSSQLKNLSELQDTSLQQLVSQRHSTPQNKNAVSVHSNLNSEAVMKSLTQTFATVEVGRWNNNKKSPIKASDLTKFGDCGGSDDEEESTVISVSEDMNSEGNVDFECDTKLYTSAPNTSQGKDNSVLLVLSSDESQQSENSENEEDTLCFVENSGQRESLSGDTGSLSCDNALFVIDTTPGMSADKNFYLEEEDKASEVAIEEEKEEEEDEKSEEDSSDHDENEDEFSDEEDFLNSTKAK,VLLLMGFKRIQKVVLDLMPELLLNHRPLGSKVSLELLKLERGRAELQAHYQRGLNHLRMEKPLRQSQIILCLSTMIPFGLGEGRSLHAPQCPVLGKSRKLQQRSLTLKKCLKQNLMFQVFLELCFLQKKLQEPEEVRLNLQIQAKNLIQKLYLMLRHQAQTFHSLELQLEEPGVCRGNRHKLKRKIVRLYQEMRNRSWVHLIQRIQIPDKLPIYKQDLFLRISQISIIMTLMMISPTEVQKIYQCTNRPMLNLLKKQNRIVRIWMKMPMEQMRGKKLMRKVLSRIFLNFRTLAFNSFLRDIQPPKIKMLYQCTLITLRLNHLKHLQLWKADGITTKRAPKQVTQSLVIVVVVMMKKSPQLVSVKTTVKGMILNVIPNYTRLRPTHLRVKIILSYFSAVMKANSLKTVRMKRILYVLLKIVAKGSHVETQEVCHVTMHCLLTQLLEVLIKIFTWKRKTRQVRLPLRKKKKRKRMKKVKKIHQTMTKMKMSLVMKKTSIAQRLN,FCCWDSSASRKYWICPNYCITDHWEAKFNPNSSKEEEQNYRLTTKGDTIYGWRNLGRVKLFCVAPYHFKGNEKADLNCMLPSVQCEKAESNSNKGVLHRNSVSRISCFRYFNCASYRKNYRSQKKGISDRSKPRISYRSYICDIKLRHFILWNCNKNQEYAEEIKGTNKERDCTRKETDRGYTCEFRGFRYQTNFPFTSKISFDKAKFLLFLPQKFRKYINSARTGQCISRNKTELGFGRCQWNNRGERNEKFSAEESFTSGHPSTVSFSETFNPPKKCCISALSELGCNEIINSNICNCGSRQMEQQKEPHKSKLDKVWLWWRRVHSYKCQRHEQRECRFMYQTIHVCAQHISGRFCLTSSQQKPTVKQERGYFMFCKWPKGVIKWRHRKSVMQCIVCNHNSWNECKFLLGRGRQGKGCHGRKRRGRGKKRRFIRPRKRVRRLPKHKGT

Amino Acids from 3' Exons

SFAANGIQAHPESSTGSDARTTAESQTTGKQSLIPRTPKARKRKSRTTGSLPKGTEPSTDGETSEAESNYSVSEHHDTILRVTRRRQILIACSPVSSVRKKPKVTPTKESYTEEIVSEAESHVSGISRIVLPTEKTTGARRSKAKSLTDPSQESHTEAISDAETSSSDISFSGIATRRTRSMQRKLKAQTEKKDSKIVPGNEKQIVGTPVNSEDSDTRQTSHLQARSLSEINKPNFYNNDFDDDFSHRSSENILTVHEQANVESLKETKQNCKDLDEDANGITDEGKEINEKSSQLKNLSELQDTSLQQLVSQRHSTPQNKNAVSVHSNLNSEAVMKSLTQTFATVEVGRWNNNKKSPIKASDLTKFGDCGGSDDEEESTVISVSEDMNSEGNVDFECDTKLYTSAPNTSQGKDNSVLLVLSSDESQQSENSENEEDTLCFVENSGQRESLSGDTGSLSCDNALFVIDTTPGMSADKNFYLEEEDKASEVAIEEEKEEEEDEKSEEDSSDHDENEDEFSDEEDFLNSTKAK,VLLLMGFKRIQKVVLDLMPELLLNHRPLGSKVSLELLKLERGRAELQAHYQRGLNHLRMEKPLRQSQIILCLSTMIPFGLGEGRSLHAPQCPVLGKSRKLQQRSLTLKKCLKQNLMFQVFLELCFLQKKLQEPEEVRLNLQIQAKNLIQKLYLMLRHQAQTFHSLELQLEEPGVCRGNRHKLKRKIVRLYQEMRNRSWVHLIQRIQIPDKLPIYKQDLFLRISQISIIMTLMMISPTEVQKIYQCTNRPMLNLLKKQNRIVRIWMKMPMEQMRGKKLMRKVLSRIFLNFRTLAFNSFLRDIQPPKIKMLYQCTLITLRLNHLKHLQLWKADGITTKRAPKQVTQSLVIVVVVMMKKSPQLVSVKTTVKGMILNVIPNYTRLRPTHLRVKIILSYFSAVMKANSLKTVRMKRILYVLLKIVAKGSHVETQEVCHVTMHCLLTQLLEVLIKIFTWKRKTRQVRLPLRKKKKRKRMKKVKKIHQTMTKMKMSLVMKKTSIAQRLN,FCCWDSSASRKYWICPNYCITDHWEAKFNPNSSKEEEQNYRLTTKGDTIYGWRNLGRVKLFCVAPYHFKGNEKADLNCMLPSVQCEKAESNSNKGVLHRNSVSRISCFRYFNCASYRKNYRSQKKGISDRSKPRISYRSYICDIKLRHFILWNCNKNQEYAEEIKGTNKERDCTRKETDRGYTCEFRGFRYQTNFPFTSKISFDKAKFLLFLPQKFRKYINSARTGQCISRNKTELGFGRCQWNNRGERNEKFSAEESFTSGHPSTVSFSETFNPPKKCCISALSELGCNEIINSNICNCGSRQMEQQKEPHKSKLDKVWLWWRRVHSYKCQRHEQRECRFMYQTIHVCAQHISGRFCLTSSQQKPTVKQERGYFMFCKWPKGVIKWRHRKSVMQCIVCNHNSWNECKFLLGRGRQGKGCHGRKRRGRGKKRRFIRPRKRVRRLPKHKGT