McDonnell Genome Institute

Washington University

CircRNA

chr1|93674613|93674941|-|BCAR3|ENST00000260502.10

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9654

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

VENYGCR

Amino Acids from 5' Exons

SELWLQENLQAFPETCRITSSPWPHPWTFAAGPLSLSIAQMPIKMCLYMAPFHGRKKVLLPGPVMTSVTWAPSPTPNPHGRTRLPRMASRRAHGRTGTAKPSPS,VENYGCRKICKPSQKHAGESPVPPGLIHGPSEQQVPSRASPRCLSRCVYTWHPSTEEKRSSSHKVLLQSHGHPPPLQIPTAELACDPGWHPGEPMAGPARRNLHLQ,LRIMAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTF

Amino Acids from 3' Exons

SELWLQENLQAFPETCRITSSPWPHPWTFAAGPLSLSIAQMPIKMCLYMAPFHGRKKVLLPGPVMTSVTWAPSPTPNPHGRTRLPRMASRRAHGRTGTAKPSPS,VENYGCRKICKPSQKHAGESPVPPGLIHGPSEQQVPSRASPRCLSRCVYTWHPSTEEKRSSSHKVLLQSHGHPPPLQIPTAELACDPGWHPGEPMAGPARRNLHLQ,LRIMAAGKFASLPRNMPVNHQFPLASSMDLLSSRSPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDDFSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGETFTF