McDonnell Genome Institute

Washington University

CircRNA

chr1|925921|939412|+|SAMD11|ENST00000616125.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9237

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

LYHLGLPSHGK

Amino Acids from 5' Exons

GKVRRLCPRGSCRCILRSATARAAEYPPR,EKSEDAYVQGDPAGASSDLRLPGLPNILPG,KSLKTLMSKGILQVHPPICDCPGCRISSPV

Amino Acids from 3' Exons

QRRCCCRGSWGPAWPRRTITAGLCQHARPAPLRTLSASTTWASPAT,RGAAAAAGAGAQHGPGGPLPPACVSTERGQHLGPSAPLPPGPPQP,EALLLPRELGPSMAPEDHYRRLVSALSEASTFEDPQRLYHLGLPSH