McDonnell Genome Institute

Washington University

CircRNA

chr1|89190037|89195424|-|GBP4|ENST00000355754.6

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9098

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

23

Peptide

ASGCGVCPTSLSQTTPWSFWTPR

Amino Acids from 5' Exons

GWGLWWLMMPSTVEQYLVWRMQQHWPSLRTQRLCRGQPTTIASRWPSNGSPQTRSRSCWTCMQPVRGKPLQSSWSTPSRMKTMNSRRSL,AGDSGGDLCRCHQQWSSTLSGECSDSTGPAEPSGCAEGSRPLPADGPATEAPHRHAPGAAGRACSLEGSHCSLHGALLQGKPIPEEAC,LGTLVVTYVDAINSGAVPCLENAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACEREAIAVFMEHSFKDENHEFQKKLV

Amino Acids from 3' Exons

ASLWAPRCSLKLRASGCGVCPTSLSQTTPWSFWTPRAWAMK,LPSGLHGAVNGHLDVVCAPPLAKPHPGPSGHRGPGRCRK,FPLGSTVQSETKGIWMWCVPHLSKPNHTLVLLDTEGLGDVEK