McDonnell Genome Institute

Washington University

CircRNA

chr1|89112471|89117234|-|GBP2|ENST00000370466.3

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9879

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

GIQVLIR

Amino Acids from 5' Exons

AQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDVKQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQ,PSWKQGEMTFVSRIPKHHQIVAWLYFRIYLALKKMSSREHFLNQEVTVSLLRSCRSRISTTRCQGRGY,PVGSKARLLAEFQSIIRLLHGFTSGYIWPFRRRCQAGNIFTRRLPSLYSEAAGAEEVLPGAKEGDT

Amino Acids from 3' Exons

VLIRKVKALMILGCASESSSPRGSASSSIGPLLRSTLLTSSRRKSTLISNKLQNFVPTSSAIPMSRLFQVAFQSMGL,YEKKLSSVVHPKVLPQEEVLRLRLARSEVPCSPRAAKGGRAEPFHRTSCRILFLHPQPFQCQDSFRWHSSQWA,TDKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGP