McDonnell Genome Institute

Washington University

CircRNA

chr1|89008946|89014279|-|GBP3|ENST00000235878.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9669

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

ADTSNPIK

Amino Acids from 5' Exons

WNVKLNLHRLQQKWWRKCKSISRWKRKRRVIKNMNNLRRWRGRGPSCWKSKRRPSLVNF,GMCKSICTGFSKNGGGNANKVSADDGREREELSRTCETIDEDGEGEGPVAGRAREDPHTS,ECVKAESAQASAKMVEEMQIKYQQMMEEKEKSYQEHVKQLTEKMERERAQLLEEQEKTLTSKLQ

Amino Acids from 3' Exons

LCDRADTSNPIKILTEEGFSLCELLPRFCVDTERFLPGLGSRWTTPHTRVPGVFPEANA,YVTELTHRIRSKSSPDENENEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLEYSLKLTQ,MQSHIESDQNPHLMRMRMRIQLTLASSQILCGHEISPWTWKQMDNPSHQMSTWSIPSRK