McDonnell Genome Institute

Washington University

CircRNA

chr1|86354529|86360536|-|ODF2L|ENST00000294678.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9712

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

QKTTLAALK

Amino Acids from 5' Exons

KIRTDGRRKRAEEAGKPRRMSAQQSVREICRVYSIGQTTGSCFRRRKTK,KLEQMDAENKELEKKLANQEECLKHSNLKFKEKSAEYTALARQLEAALEEGRQK,NNRWTQKIKSLRRSWQTKKNVLSTAILSLKRNLQSIQHWPDNWKLLKKEDK

Amino Acids from 3' Exons

TTLAALKDEVVSVENELSELQEVEKKQKTLIEMYKTQ,LHLLLRMKLYLLKMNSQNCKKKKNRKPLLKCIKL,YTCCFEGSCICKTLRIARSRKKTENPYNVNS