McDonnell Genome Institute

Washington University

CircRNA

chr1|84196615|84202805|+|PRKACB|ENST00000370680.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

RLFLESEPHAR

Amino Acids from 5' Exons

APCTVLCSSDSANIRVPPFTRPHLQRSKTKSLNPSRLYP,EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQ,SPMHGSMQLRCHSSTSIHTSSTEINLKISLTIKAIS

Amino Acids from 3' Exons

GYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGK,ATIRQWIGGHECSMKWQLAIPHSLQTNQFRFMKRLFLE,LQGSGLVGIRSANLNGSWLSPILCRPTNSDLKDCFWK