McDonnell Genome Institute

Washington University

CircRNA

chr1|77962769|77963715|-|FUBP1|ENST00000294623.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9989

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

14

Peptide

IGAGNPGGPGPGGRGR

Amino Acids from 5' Exons

EVKPKAASSLVQENFREILHQMQILISYLQFVALHNRTMLGNSKKRL,RNHKKHKPAVWCKNRTSEKSSTKCRSYEVIYNSWHSTTDRLCSATHRRKDW,GETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIG

Amino Acids from 3' Exons

AGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGK,LVILVDLDLVVEEEVEVKATGTWDHLVDYRNLILLCQLGKLDEK,WSWWTWTWWSRKRRSRQLEHGTTWWTTGIFYCANWENWINNRK