McDonnell Genome Institute

Washington University

CircRNA

chr1|77926715|77929504|+|NEXN|ENST00000330010.12

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9463

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

NMDDEIESEAKK

Amino Acids from 5' Exons

DDEIESEAKKESLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQM,MMKKVKQKKNHFLPENNLLKNWSDKDKKTERSKLKRKQENVKKRSVLLKKQGGK,NRKSKKRITFSRKIETNFRTGATKTRKPKEASRGSKKTFRRREACFRSKAAN

Amino Acids from 3' Exons

VNEDEENQDTAKIFKGYRPGKLKLSFEEMERQRREDEKRKAEEEARRRIEEEKKAFAEARRNM,MKMRKTKTQQKFLKGTALVNSNSVLKKWKGKEEKMKKGKQKKKPEGERKKRRRLLKQGEI,KRGKPRHSKNFRVPPWTQTQFRNGKAKKRRKKESRRRSQKENRGRKEGVCSKEKY