McDonnell Genome Institute

Washington University

CircRNA

chr1|75789158|75790274|+|RABGGTB|ENST00000471759.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9911

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

STGTEGASLK

Amino Acids from 5' Exons

EYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFIKSCQHECGGISASIGHDPHLLYTLSAVQ,NTVCLSIEVASIGVQWISWDNFIAIEKRFWHLLSLANMNVVEVLVSDMILIFYTLLVLS,ILYVVFENEWHLLGSDSNGSHGTTSSHERRDSGIYVLPTMWWNKCYRTSSSFIHSCCP

Amino Acids from 3' Exons

VPLSSWSNWSWSAGTSSMHCGSYISIYRSTGTEGASLKDK,SHAAGLTGVNGLLELPACTVVVISAYTGALEQRGPVKI,PTKQLVLELMVCWNFQHALWLYQHIQEHWNRGGQSKR