McDonnell Genome Institute

Washington University

CircRNA

chr1|68153516|68155260|-|WLS|ENST00000262348.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9358

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LEEDHHDVPTPSASGK

Amino Acids from 5' Exons

GIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE,GSTKMEASPRCGLPRPSLRPASSSLWCGIGGGSPCPDPQCFWK,DPPKWRLHQGVVCHEDLPYAQHLHHYGVVLEEDHHDVPTPSASGK

Amino Acids from 3' Exons

TPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLV,LQSMRAVTMNVMSFLSWKLGLWPISFTFTSGCLMRRRKSMWELGRRISGW,SRAGPLLMCPSFHGNWVCGPVLPFKHPAACEEEENQCGNWGDKGYPVG