McDonnell Genome Institute

Washington University

CircRNA

chr1|66926141|66981918|+|MIER1|ENST00000355977.10

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

FSQCLAEFR

Amino Acids from 5' Exons

MVWSLDSPSAWLSFGRGEPTGGSMQTRRMC,WCGRSILPVPGVSDVVKNQLVEVQCRQDGCDA,GVVARFSQCLAEFRTWLRTNWLRFNADKTDVML

Amino Acids from 3' Exons

GLHGSSSRRKKCCISSTIPSPNCIKQQPVERRWHCKHCSK,DYMDRLLDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQN,ITWIVFTKVKVLHLVEHHPLPQLHQTVVTASLRKKMALALLIKM