McDonnell Genome Institute

Washington University

CircRNA

chr1|6652828|6681037|-|DNAJC11|ENST00000294401.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9568

36

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

GWGEASSEELK

Amino Acids from 5' Exons

APLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGE,HPQRQTQPSSLEASQPRMEMEEVPLTLRSDELRQRDGE,TLDSDRHSHPLWKPLNPEWKWRRFHLCAQTSNFGKGMGR

Amino Acids from 3' Exons

ASSEELKAAYRRLCMLYHPDKHRDPELKSQAERLFNLVHQAYE,PLLKSKLPTGGSVCSTIQTSTETQSSSHRRNDCLTLFTRLMK,LFRAESCLPEALYALPSRQAQRPRAQVTGGTTVPCSPGL