McDonnell Genome Institute

Washington University

CircRNA

chr1|64647800|64654803|+|CACHD1|ENST00000290039.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9084

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

LEDDGVTGLK

Amino Acids from 5' Exons

MGLVKSWLFGILNRIQGSTVCQTGWPCLLRAAWCISATWRPQWAGSTQTFPTGLMKPSSACPSLMRWEM,WGDWFERAGFSEGSSTEFREVRCARPDGLACDGQHDGAESVEQPGDHSGQVLHKPSQPDDSRLQPALLDGR,GVTGLKELAFLRDLAEQNSGKYGVPDRMALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGD

Amino Acids from 3' Exons

PPSGQPDYRSPCELIPVLAHKQAERNWKGSLQCLCLED,LPLGSQIIAVPVNSSLSWHINKLRETGKEAYNVSYAWKM,SLWAARLSQSLTHPCLGTTSEKLERKPTMLAMPGR