McDonnell Genome Institute

Washington University

CircRNA

chr1|6294863|6327413|-|ACOT7|ENST00000361521.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9718

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

11

Peptide

SEKYSRQEQEEEGR

Amino Acids from 5' Exons

VPSSWMRSPGSWLHATARPTSSQLPWTPLIFMTRSEK,CDHEAHGGRRDRGCTPLQDQHRHSFRGRHFSQDQK,VTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRK

Amino Acids from 3' Exons

YSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNP,IPGRSRRRRAGSGMKPRSWSAWRPSGGTGTSSSQSSTQ,FPAGAGGGGPEAVSPEAGAHGDQVEERGHRPASPQP