McDonnell Genome Institute

Washington University

CircRNA

chr1|62555824|62586624|-|DOCK7|ENST00000251157.9

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9731

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

VLILPIVK

Amino Acids from 5' Exons

LTVKHLLKPWHQLIDFTKTWKEIMTSMAETAFLHHIFIMFSAYQILTLIHHHQ,PRSSIFSHGINYKSTSQKLGRKSPAWQKQPSCIIYSLCFPPTKYLPFIIT,NLGQASFEAMASIINRLHKNLEGNHDQHGRNSLLASYIHYVFRLPNTYPNSSSP

Amino Acids from 3' Exons

KSSLHIPSESFCQSSRFCKYNSESPVYVWRGSKQCHA,NLLYIYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMP,IFSTYTLRVLILPIVKVLLEIQKSSLCMERIQAMPC