McDonnell Genome Institute

Washington University

CircRNA

chr1|61990167|62084648|+|INADL|ENST00000316485.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9838

35

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

MDLDSALLVIK

Amino Acids from 5' Exons

KKSDKDMQICLENCTLLNLKKIRMDLDSALLVIKTDHAAYLWWELTRKDLLPQMDECVLEMNS,KNQTKICRSAWRTAHYTKREWTWTQPCWRPITHEHICGGNPGRTCCRRWTNAYWRTLR,KIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLE

Amino Acids from 3' Exons

VVSRLLCQWTPQRVPLSLDRKLKYPRDVQGLVSALWEEKTHP,WFPGSSVSGPRNVSHCPWTGNDYRNIQGTFRAWSQHCGRKRHTL,GFQAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPL