McDonnell Genome Institute

Washington University

CircRNA

chr1|61856029|62079567|+|INADL|ENST00000316485.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9861

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

6

Peptide

QTSQAMDPLDPTR

Amino Acids from 5' Exons

DPLDPTRSVIVIRSLVADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGICKPLV,TLILQDQLSAPWQMVQKEVGDYYLETAWSQSMNTVWTTPHLLKLWKYKLCHQAYTLASVSLW,PFRSYKISDCDPLPGSRWCSRKKWGTITWRPPGLSQILFGQHLTCSCGNIESCATRPSTPWHLAFG

Amino Acids from 3' Exons

AVSQMKQQKYPTKVSFSSQEIPLAPASSYHSTDADFTGY,LSARNSKNIQQKSPSVHKRYHHQLHHTIQQMQTSQAM,CQPDETAKISNKSLLQFTRDTISTSFIIPFNRCRLHRL