McDonnell Genome Institute

Washington University

CircRNA

chr1|5904616|5933329|-|NPHP4|ENST00000378156.8

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9741

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

17

Peptide

MAPLMLAASVTSLSNLACMHMVR

Amino Acids from 5' Exons

SGPGLPRNIMAKDCVFHLPVLPLPTRNDATTAAGPAGGRPAQLWRPDPHPRACEQRWHLC,VAQDCRGTSWPKTVYFTFQFYRFPPATTPRLQLVQLDEAGQPSSGALTHILVPVSRDGTFDA,WPRTAEEHHGQRLCISPSSSTASHPQRRHDCSWSSWMRPASPALAPPTSSCLAEMAPLML

Amino Acids from 3' Exons

AASVTSLSNLACMHMVRWAVWNPLLEADSGRVTLPLQGGIQPNPSHCLVYKVPSASMSSEE,QLRSPLCPTWHACTWSAGLFGTPCWKLILEGPCLCRVGSSPTPRTVWSTRYPQPAALK,SFGHLSVQPGMHAHGPLGCLEPLAGSFWKGDPASAGWDPAQPLALSGLQGTLSQHELR