McDonnell Genome Institute

Washington University

CircRNA

chr1|56940848|56956910|-|C8B|ENST00000371237.8

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

EVEDCVTNRPCGSQVR

Amino Acids from 5' Exons

TETRGTPWWRTWWSWYEEGQVSTSPPWHTRSCRRRTCRSGETLCSTTQPSSKL,QKQEGHHGGGLGGPGTRRGKAHHHPGIPGAADGGPDAGVGRRCAVQPSHHQS,RNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVK

Amino Acids from 3' Exons

YRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCGSQVRCEGFVCAQT,TGMPTCSSPLSSMGNRATSLTRKSKTVLPTDHAEVKCDVKALCVHRQ,QVCLLAPALSVPWGTVQLLQGSRRLCYQQTMRKSSAMRLCVCTD