top of page

McDonnell Genome Institute

Washington University

CircRNA

chr1|56881444|56886167|+|C8A|ENST00000361249.3

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9306

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

6

Peptide

AKMESLGTIS

Amino Acids from 5' Exons

VQYPDPGRCSECVRCQLLWGPVDGIQWGMEGASILHLTSLLWREILSETLQLSEVPL,YNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFE,TISPRKMLRVCTMPVIMGASVRRYTMGNGGSFDMTPPVNVSTMEMMRNTFGNPTTFSTTL

Amino Acids from 3' Exons

KFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESL,NSFSQESSQRCRLHILRGRMTLCWMKECCSHWSFQISTIMACMPSSSMTMAPITSHLDPWVAFMNISWLTKQKWNPL,IHFHKNLHKGADCTFDEEGHYAGRNAAVINGASRSVQLWHVCQVHQLWHPLHHIWIHGWHLIYPGDQSKNGIP

bottom of page