McDonnell Genome Institute

Washington University

CircRNA

chr1|55124468|55129574|-|USP24|ENST00000294383.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.994

45

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

LQDGLILLGVASQLK

Amino Acids from 5' Exons

TMEVSDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKESNSLCPAGIRNRLSSS,QWKVISLLLWLASDCHGLRLQDGLILLGVASQLKKVIPCVLLEFETDSAVQ,NGSKFHFYCGLLHEIVMGCGCRTASCWEPANRKFPVSCWNSKQTQQF

Amino Acids from 3' Exons

VLSSKLMPTADDDMARSCAKSFCENFLKAGGL,FAPNSCQQLMMTWPEAVPNPSVKTSSKLAV,SKLQTHANSHGQKLCQILLKLPQSWRFE